(data stored in ACNUC7421 zone)

EMBL: CP000820.PE84

CP000820.PE84        Location/Qualifiers
FT   CDS             102255..103571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0086"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   lxx:Lxx22040 putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09553"
FT                   /db_xref="GOA:A8LB92"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB92"
FT                   /protein_id="ABW09553.1"
FT                   /translation="MTTARSTTGASPTDAPTQDGTSPTSKSGPATHLGPVPDANLVLRP
FT                   ARLAARELVRVGAAGLRSRPTRVALSALGIAIGIAAMISVIGISSSSREDFHRQIAALG
FT                   TNLLTVSPGQNLFGDQAHLPTEAVTMIGAVGDVESVSATGLVPDARVYRNDHIPAAESG
FT                   SIAVLATRLDLPDTVGADIVAGTYLNEATQRYAAVVLGSTAAAHLGVDSTGPDQQIHLG
FT                   GQWFTVVGILAPVGLAPELDRAALVGWPSAADLLGFDTYPTTLYTRTDPNHVEAVQTLL
FT                   ARTANPAAPNEVDVSRPSDALAAQHAADSTLGGLLLGLGSVALLVGGIGVANTMVISVL
FT                   ERRGEVGLRRALGATRGDIRNQFLAEALLLSTLGGIAGLILGTGVTTCYATTQAWPTVV
FT                   PSWAMLLAFGATLVIGAVAGLYPATRASRLQPTAALAAP"
     MTTARSTTGA SPTDAPTQDG TSPTSKSGPA THLGPVPDAN LVLRPARLAA RELVRVGAAG        60
     LRSRPTRVAL SALGIAIGIA AMISVIGISS SSREDFHRQI AALGTNLLTV SPGQNLFGDQ       120
     AHLPTEAVTM IGAVGDVESV SATGLVPDAR VYRNDHIPAA ESGSIAVLAT RLDLPDTVGA       180
     DIVAGTYLNE ATQRYAAVVL GSTAAAHLGV DSTGPDQQIH LGGQWFTVVG ILAPVGLAPE       240
     LDRAALVGWP SAADLLGFDT YPTTLYTRTD PNHVEAVQTL LARTANPAAP NEVDVSRPSD       300
     ALAAQHAADS TLGGLLLGLG SVALLVGGIG VANTMVISVL ERRGEVGLRR ALGATRGDIR       360
     NQFLAEALLL STLGGIAGLI LGTGVTTCYA TTQAWPTVVP SWAMLLAFGA TLVIGAVAGL       420
     YPATRASRLQ PTAALAAP                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page