(data stored in ACNUC7421 zone)

EMBL: CP000820.PE85

CP000820.PE85        Location/Qualifiers
FT   CDS             103928..104269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:pnf1300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09554"
FT                   /db_xref="GOA:A8LB93"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB93"
FT                   /protein_id="ABW09554.1"
FT                   /translation="MAVTCRFGGNCVMMYWSDRDISGWGWFAMSMGMLLFWAVLITVAV
FT                   LLVRALIRSDERRRPATRSPSEPGAAHGPAVPSPEEVLADRFARGEIDEQEYRVRLATL
FT                   RDTARFVKH"
     MAVTCRFGGN CVMMYWSDRD ISGWGWFAMS MGMLLFWAVL ITVAVLLVRA LIRSDERRRP        60
     ATRSPSEPGA AHGPAVPSPE EVLADRFARG EIDEQEYRVR LATLRDTARF VKH              113
//

If you have problems or comments...

PBIL Back to PBIL home page