(data stored in ACNUC7421 zone)

EMBL: CP000820.PE89

CP000820.PE89        Location/Qualifiers
FT   CDS             complement(107696..108688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0091"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sco:SCO5075 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09558"
FT                   /db_xref="GOA:A8LB97"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB97"
FT                   /protein_id="ABW09558.1"
FT                   /translation="MKAAAFARHGGPEVLELMDLATPVAGPGQVRVRLRFAGVQPIDCA
FT                   VRAGWAPPGVAPRLPTIPGNEFAGVVDQVGDRVDGVGGADGADGVGGIDSVGGVDGGDH
FT                   GVVVGAEVLGFGQLGAYAEYLVVPADQVTAKPAGMPWEVAGGFSGGAQTAHIALRELGV
FT                   GKGDTVLIHAAAGGVGTVAVQLAVRAGSTVIGTAGAANHDYLRSLGAIPVAYGDGLVER
FT                   VQAIAPGGVDAALDGAGGDALTASLALVADRSRILTLVEHGRAGELGIRVTPNLRSAAR
FT                   LAELADLQAHGALHINVRRVVPLADAAEAHRELETRHGRGKIVLAVSSG"
     MKAAAFARHG GPEVLELMDL ATPVAGPGQV RVRLRFAGVQ PIDCAVRAGW APPGVAPRLP        60
     TIPGNEFAGV VDQVGDRVDG VGGADGADGV GGIDSVGGVD GGDHGVVVGA EVLGFGQLGA       120
     YAEYLVVPAD QVTAKPAGMP WEVAGGFSGG AQTAHIALRE LGVGKGDTVL IHAAAGGVGT       180
     VAVQLAVRAG STVIGTAGAA NHDYLRSLGA IPVAYGDGLV ERVQAIAPGG VDAALDGAGG       240
     DALTASLALV ADRSRILTLV EHGRAGELGI RVTPNLRSAA RLAELADLQA HGALHINVRR       300
     VVPLADAAEA HRELETRHGR GKIVLAVSSG                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page