(data stored in ACNUC7421 zone)

EMBL: CP000820.PE96

CP000820.PE96        Location/Qualifiers
FT   CDS             complement(115711..117012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0098"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: msm:MSMEG_4826
FT                   putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09565"
FT                   /db_xref="GOA:A8LBA4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBA4"
FT                   /protein_id="ABW09565.1"
FT                   /translation="MSWDFETEPEYQAQLDWADKFVREEVEPLDMAWPDLQFVPRGETL
FT                   QRVIDPLRQQVKDHGLWATHLGPELGGQGHGQLKLSLLNEILGRSSWAPIVFGCQAPDT
FT                   GNAEIIAHYGTEAQKKQYLQPLLDGECFSSYSMTEPQAGSDPTQFTCSAVKDGDGWVIN
FT                   GWKFFSSNASTARFVIVMVVTNPDVSRYRGMSMFLIPTDTPGINIVRNVGLPGEPLGEG
FT                   HHALIHYEDVRVSDDALLGGEGQAFAIAQTRLGGGRIHHAMRTIGLAKKALDMMCERAL
FT                   SRSTQGSLLADKQFVQGFIADSYAQLAQFRLFVLYTAWSIDKHKDYRKVRKDIAAVKVV
FT                   MPAVLHDIASRALQVHGALGASNEMPFHQMVMGSFVMGLADGPTEVHKVTVAKQVLRDY
FT                   KPTDDLWPTEHLPKRLAAAREKYAEYLELEVGNL"
     MSWDFETEPE YQAQLDWADK FVREEVEPLD MAWPDLQFVP RGETLQRVID PLRQQVKDHG        60
     LWATHLGPEL GGQGHGQLKL SLLNEILGRS SWAPIVFGCQ APDTGNAEII AHYGTEAQKK       120
     QYLQPLLDGE CFSSYSMTEP QAGSDPTQFT CSAVKDGDGW VINGWKFFSS NASTARFVIV       180
     MVVTNPDVSR YRGMSMFLIP TDTPGINIVR NVGLPGEPLG EGHHALIHYE DVRVSDDALL       240
     GGEGQAFAIA QTRLGGGRIH HAMRTIGLAK KALDMMCERA LSRSTQGSLL ADKQFVQGFI       300
     ADSYAQLAQF RLFVLYTAWS IDKHKDYRKV RKDIAAVKVV MPAVLHDIAS RALQVHGALG       360
     ASNEMPFHQM VMGSFVMGLA DGPTEVHKVT VAKQVLRDYK PTDDLWPTEH LPKRLAAARE       420
     KYAEYLELEV GNL                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page