(data stored in ACNUC7421 zone)

EMBL: CP000820.PE97

CP000820.PE97        Location/Qualifiers
FT   CDS             complement(117226..118992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0099"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: fal:FRAAL5548 hypothetical
FT                   protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09566"
FT                   /db_xref="GOA:A8LBA5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBA5"
FT                   /protein_id="ABW09566.1"
FT                   /translation="MGHSRRRDRLFRRAAVGAAVLTGACVVLAQVLPDSLALSAVRLTV
FT                   IGFLLLGGTTCVVAGLRRHGAERWWRLLMAVMVLAVAVASAAVFRDTAAGRSPVPQLTP
FT                   ASLVYLIPLAMGVAGVLLYPTDPVEHDDAEDGGPLHAYRWYAITVLDGMIVVGSVALLV
FT                   WATVLERTVGHGEPLGPGPLYSIILAAVSLVVFVVLILVAVFREPRDSRGHALLLAGMC
FT                   AASISAMWELAVLIHGLDDVPRLTDLPIGIGALLIGLAAISTDPDTGATTGADAAADVD
FT                   VDADADAVGVGLAAVPSLGRRAASARLRRWHAILPYLPLTAAGAATVLQIAGDGIGHWE
FT                   EIWALLALLLLALVRQMMTMSDNIRLLGQVEEKQRQLRHQAFHDPLTGLANRSLFIDRL
FT                   ERALHRQPGPAERFAVLFCDLDDFKRVNDVLGHAAGDDLLRITGARLAGCVRAADTVAR
FT                   LGGDEFAILLVSANIDDPEAVGCRLAAAVRAPVRLASHTFTVAASVGLVTVDPETGTGA
FT                   PHQGADPDPDPDTDTEPRADVPDTAEQLLHRADLAMYAAKARRNGEPAVYTPELVGPGR
FT                   ARARPARNVPLP"
     MGHSRRRDRL FRRAAVGAAV LTGACVVLAQ VLPDSLALSA VRLTVIGFLL LGGTTCVVAG        60
     LRRHGAERWW RLLMAVMVLA VAVASAAVFR DTAAGRSPVP QLTPASLVYL IPLAMGVAGV       120
     LLYPTDPVEH DDAEDGGPLH AYRWYAITVL DGMIVVGSVA LLVWATVLER TVGHGEPLGP       180
     GPLYSIILAA VSLVVFVVLI LVAVFREPRD SRGHALLLAG MCAASISAMW ELAVLIHGLD       240
     DVPRLTDLPI GIGALLIGLA AISTDPDTGA TTGADAAADV DVDADADAVG VGLAAVPSLG       300
     RRAASARLRR WHAILPYLPL TAAGAATVLQ IAGDGIGHWE EIWALLALLL LALVRQMMTM       360
     SDNIRLLGQV EEKQRQLRHQ AFHDPLTGLA NRSLFIDRLE RALHRQPGPA ERFAVLFCDL       420
     DDFKRVNDVL GHAAGDDLLR ITGARLAGCV RAADTVARLG GDEFAILLVS ANIDDPEAVG       480
     CRLAAAVRAP VRLASHTFTV AASVGLVTVD PETGTGAPHQ GADPDPDPDT DTEPRADVPD       540
     TAEQLLHRAD LAMYAAKARR NGEPAVYTPE LVGPGRARAR PARNVPLP                    588
//

If you have problems or comments...

PBIL Back to PBIL home page