(data stored in ACNUC7421 zone)

EMBL: CP000820.PE98

CP000820.PE98        Location/Qualifiers
FT   CDS             complement(119081..119740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0100"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL3558
FT                   putative TetR transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09567"
FT                   /db_xref="GOA:A8LBA6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBA6"
FT                   /protein_id="ABW09567.1"
FT                   /translation="MSDTAGVEWEGTPASVRAAVDRALNRHQRDALVEVEQILDAALRV
FT                   AVRVAPADPKVADIVAEAGTSNQTFYRYFAGKNELMHAVLERGIVILRSYLRHQMSKKS
FT                   DPAGQMTAWVDGMIAQITRPAVAQQGATVNRLLARASDSVPGRATLDQQLGQLLVPPLT
FT                   AAGRPRPDLDARLIQDAVLGTMQRHVEPCTVPTEDEQRHLIDFCVSILQAGPAAAH"
     MSDTAGVEWE GTPASVRAAV DRALNRHQRD ALVEVEQILD AALRVAVRVA PADPKVADIV        60
     AEAGTSNQTF YRYFAGKNEL MHAVLERGIV ILRSYLRHQM SKKSDPAGQM TAWVDGMIAQ       120
     ITRPAVAQQG ATVNRLLARA SDSVPGRATL DQQLGQLLVP PLTAAGRPRP DLDARLIQDA       180
     VLGTMQRHVE PCTVPTEDEQ RHLIDFCVSI LQAGPAAAH                              219
//

If you have problems or comments...

PBIL Back to PBIL home page