(data stored in ACNUC7421 zone)

EMBL: CP000821.PE10

CP000821.PE10        Location/Qualifiers
FT   CDS             complement(11580..12326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0010"
FT                   /product="LamB/YcsF family protein"
FT                   /note="KEGG: slo:Shew_0006 LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34623"
FT                   /db_xref="GOA:A8FP50"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP50"
FT                   /protein_id="ABV34623.1"
FT                   /translation="MLSNPKGYPIDLNADLGEGSEFDAELLLLITSANIACGGHAGDPL
FT                   SMRKTVIQALKSKVNVGAHPSFPDRENFGRVSIDISGKQLSDSIYQQIMALRAICDELG
FT                   AKLFHVKPHGAFYNEVAKDKVLGRILIDVIKRIDPELKLMILAGSPLVKQARQHGLTVI
FT                   EEAFADRTYLSDGSLAPRSEVGAVIHDPQQALQQVRQIVGNMPVTTLGGQPIIINATSI
FT                   CLHGDNQQALEFAKLISENLTEARKP"
     MLSNPKGYPI DLNADLGEGS EFDAELLLLI TSANIACGGH AGDPLSMRKT VIQALKSKVN        60
     VGAHPSFPDR ENFGRVSIDI SGKQLSDSIY QQIMALRAIC DELGAKLFHV KPHGAFYNEV       120
     AKDKVLGRIL IDVIKRIDPE LKLMILAGSP LVKQARQHGL TVIEEAFADR TYLSDGSLAP       180
     RSEVGAVIHD PQQALQQVRQ IVGNMPVTTL GGQPIIINAT SICLHGDNQQ ALEFAKLISE       240
     NLTEARKP                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page