(data stored in ACNUC7421 zone)

EMBL: CP000821.PE104

CP000821.PE104       Location/Qualifiers
FT   CDS             116896..118164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0104"
FT                   /product="three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="KEGG: slo:Shew_3707
FT                   three-deoxy-D-manno-octulosonic-acid transferase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34717"
FT                   /db_xref="GOA:A8FPE4"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPE4"
FT                   /protein_id="ABV34717.1"
FT                   /translation="MNRFIYSILLYLLFPLLVIYLAVRAIKSPDYRGRWGERFGLTSLK
FT                   GSDLLIHSVSMGETLAAIPLIKAIQQAHPQLSITVTTTSPTGSAEVTKAFGDSVQHCYL
FT                   PFDLPFSVRRFLKQVDPQYCIIMETELWPNLIHQASRCGIKLMLANARLSEKSAGKYQK
FT                   QITLSQPMLQSLDSIAAQSQQAADRFIALGVNADRVEVCGSLKFDLTIADDKREQAKAL
FT                   RQQWRAVTCPVWIAGSVHPGEFDAILAAHRHLLTIYPDALLIMVPRHPEKFDAAASKIS
FT                   ESGFTLARRSLKESVDDETQVLLGDTMGELLTFYGAADQAFVGGTIVENGGHNPLEPAA
FT                   LGLPVFVGPHHWDFAEITGLLNEAGALQLVSSAEELGTALVRNFEDKSAYQVASEAGLS
FT                   VVDANKGALQHQFDLANRLIAFE"
     MNRFIYSILL YLLFPLLVIY LAVRAIKSPD YRGRWGERFG LTSLKGSDLL IHSVSMGETL        60
     AAIPLIKAIQ QAHPQLSITV TTTSPTGSAE VTKAFGDSVQ HCYLPFDLPF SVRRFLKQVD       120
     PQYCIIMETE LWPNLIHQAS RCGIKLMLAN ARLSEKSAGK YQKQITLSQP MLQSLDSIAA       180
     QSQQAADRFI ALGVNADRVE VCGSLKFDLT IADDKREQAK ALRQQWRAVT CPVWIAGSVH       240
     PGEFDAILAA HRHLLTIYPD ALLIMVPRHP EKFDAAASKI SESGFTLARR SLKESVDDET       300
     QVLLGDTMGE LLTFYGAADQ AFVGGTIVEN GGHNPLEPAA LGLPVFVGPH HWDFAEITGL       360
     LNEAGALQLV SSAEELGTAL VRNFEDKSAY QVASEAGLSV VDANKGALQH QFDLANRLIA       420
     FE                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page