(data stored in ACNUC7421 zone)

EMBL: CP000821.PE105

CP000821.PE105       Location/Qualifiers
FT   CDS             complement(119268..119990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0105"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="KEGG: slo:Shew_3706 lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34718"
FT                   /db_xref="GOA:A8FPE5"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPE5"
FT                   /protein_id="ABV34718.1"
FT                   /translation="MQIKQTSSGAIAYCDATPETISVPWFTFDYWQSQGAITGSSKGRY
FT                   TTWFVKPNMAETDKSEWVLRHYYRGGLMEKISKDSYFYTGLKNTRAVAELSLLELLYSE
FT                   GFEVPRPIAANVERNGLYYRADIIIERVEGAQDLVAQLSKSPMSDLQWQQLGACIAKFH
FT                   QRGVYHADLNAKNILITPDKFYLIDFDRGEIRTPNPKWQGANLERLLRSFRKELAKLPT
FT                   LAFNETNWQSLMQGYSNP"
     MQIKQTSSGA IAYCDATPET ISVPWFTFDY WQSQGAITGS SKGRYTTWFV KPNMAETDKS        60
     EWVLRHYYRG GLMEKISKDS YFYTGLKNTR AVAELSLLEL LYSEGFEVPR PIAANVERNG       120
     LYYRADIIIE RVEGAQDLVA QLSKSPMSDL QWQQLGACIA KFHQRGVYHA DLNAKNILIT       180
     PDKFYLIDFD RGEIRTPNPK WQGANLERLL RSFRKELAKL PTLAFNETNW QSLMQGYSNP       240
//

If you have problems or comments...

PBIL Back to PBIL home page