(data stored in ACNUC7421 zone)

EMBL: CP000821.PE11

CP000821.PE11        Location/Qualifiers
FT   CDS             complement(12470..13456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0011"
FT                   /product="UreA amidolyase related protein"
FT                   /note="KEGG: slo:Shew_0007 UreA amidolyase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34624"
FT                   /db_xref="GOA:A8FP51"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP51"
FT                   /protein_id="ABV34624.1"
FT                   /translation="MTKRNSIQVLKAGMHSSVQDLGCTGYRHLGITTGGALDRHALILA
FT                   NRLLGNSDASAGIELTSGIVELKFNCDTWFVLTGANYRISIGQRDIWCNWRNKIRAGET
FT                   LTLRGPKSGMRAYLALEGGIVDGIEGEIRDGSPETNNKLRLKSDSLLGDRFSGVLGAVL
FT                   KDGDRLALGQAGAISKPIGAVQRGYSNEIRALPGPEMPLFSEESKKAFWNSSWQLTNES
FT                   NRMGARLSGITLSLAQQQDMESHAVMPGAVQVPPAGQPIVLLADSQTTGGYPKIATVIE
FT                   ADLWKLAQTRPGEEVRFVHVSPNQADDANYEWEEYFYRLQRAIEANG"
     MTKRNSIQVL KAGMHSSVQD LGCTGYRHLG ITTGGALDRH ALILANRLLG NSDASAGIEL        60
     TSGIVELKFN CDTWFVLTGA NYRISIGQRD IWCNWRNKIR AGETLTLRGP KSGMRAYLAL       120
     EGGIVDGIEG EIRDGSPETN NKLRLKSDSL LGDRFSGVLG AVLKDGDRLA LGQAGAISKP       180
     IGAVQRGYSN EIRALPGPEM PLFSEESKKA FWNSSWQLTN ESNRMGARLS GITLSLAQQQ       240
     DMESHAVMPG AVQVPPAGQP IVLLADSQTT GGYPKIATVI EADLWKLAQT RPGEEVRFVH       300
     VSPNQADDAN YEWEEYFYRL QRAIEANG                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page