(data stored in ACNUC7421 zone)

EMBL: CP000821.PE112

CP000821.PE112       Location/Qualifiers
FT   CDS             complement(125937..127007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0112"
FT                   /product="Glycerol dehydrogenase-like protein"
FT                   /note="KEGG: chy:CHY_2583 putative glycerol-1-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34725"
FT                   /db_xref="GOA:A8FPF2"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR032837"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF2"
FT                   /protein_id="ABV34725.1"
FT                   /translation="MSDFTRKLNTRHLEFPAQLLVEKNAIANTPLLSNLPLSQGVLLAI
FT                   DDGVKTLAEQVLPHLWASKSCTTHVIEKADFTNVSQIDAICAERQIETVVAFGGGKVLD
FT                   VCKRLASLRHIELIVIPTALSSDCVSSPIAVIFDESGKKLSLPAAIPNVIIVDTKLCSQ
FT                   APRRLTQAGIGDLLSNYCALLDMNYAKDRADVDGFSYLLAKSAANEIVGMQHLSLTDQA
FT                   VITQLAEGLILSGLAMGFSGDSRPCSGAEHLISHALDFLNLGDGLHGEQVALGMKFCHH
FT                   LRLLLNLPALNPSVLACIDGFNIRSTPDSLNISKNEFFEALAISPEMRKGRMTFLEKQN
FT                   SIPKAQLEKAYINAFE"
     MSDFTRKLNT RHLEFPAQLL VEKNAIANTP LLSNLPLSQG VLLAIDDGVK TLAEQVLPHL        60
     WASKSCTTHV IEKADFTNVS QIDAICAERQ IETVVAFGGG KVLDVCKRLA SLRHIELIVI       120
     PTALSSDCVS SPIAVIFDES GKKLSLPAAI PNVIIVDTKL CSQAPRRLTQ AGIGDLLSNY       180
     CALLDMNYAK DRADVDGFSY LLAKSAANEI VGMQHLSLTD QAVITQLAEG LILSGLAMGF       240
     SGDSRPCSGA EHLISHALDF LNLGDGLHGE QVALGMKFCH HLRLLLNLPA LNPSVLACID       300
     GFNIRSTPDS LNISKNEFFE ALAISPEMRK GRMTFLEKQN SIPKAQLEKA YINAFE           356
//

If you have problems or comments...

PBIL Back to PBIL home page