(data stored in ACNUC7421 zone)

EMBL: CP000821.PE113

CP000821.PE113       Location/Qualifiers
FT   CDS             complement(127008..127427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0113"
FT                   /product="cytidyltransferase-related domain"
FT                   /note="KEGG: sfr:Sfri_3930 cytidyltransferase-related
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34726"
FT                   /db_xref="GOA:A8FPF3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF3"
FT                   /protein_id="ABV34726.1"
FT                   /translation="MSKKVLVVGVFDLFHRGHVEFLQKASEFGDELIILINGDEMTEKY
FT                   KRRPIYSEDDRATILNALSCVSQVEVTNSFDIKPIIEKYNIDVIVHGDDWEHESYLAQI
FT                   RCTQSYLDEQGVSLAYTEYHKSVSTSTLLKQIKEA"
     MSKKVLVVGV FDLFHRGHVE FLQKASEFGD ELIILINGDE MTEKYKRRPI YSEDDRATIL        60
     NALSCVSQVE VTNSFDIKPI IEKYNIDVIV HGDDWEHESY LAQIRCTQSY LDEQGVSLAY       120
     TEYHKSVSTS TLLKQIKEA                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page