(data stored in ACNUC7421 zone)

EMBL: CP000821.PE116

CP000821.PE116       Location/Qualifiers
FT   CDS             129317..130810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34729"
FT                   /db_xref="InterPro:IPR026950"
FT                   /db_xref="InterPro:IPR038636"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF6"
FT                   /protein_id="ABV34729.1"
FT                   /translation="MMENLKSFGVRAFAILSLFTSFISVSAPWVDTSDIYLRADIQALA
FT                   DEGVITVPVNTYPLMWAGIGADLSKVEPSVLPPSVAQAFARVNYYYRNAVENRGNTRIK
FT                   AAAATDAARFQHFGSDYSEQGELQASYEYMGDRFAFKASASANYDPSDEKEFRYDDSYM
FT                   AVILGNWIFTAGAVEQWWGPGFDSSMHRSNNARPLPSVMISRNNAAAFETPWLSWLGPW
FT                   TLTAGVSRLEEERAVANPLLWNFRSSLRPFRQLEVGFSWTTQFCGEGEECSWESALKSI
FT                   TGQRDCRGAGEAGCTNYGNQMAGYDIRFSDTWFDIPFGVYYEKTCEDAKGSTPWDIVDC
FT                   GHAAGVDTRFNFDNAQYKLFFEYTDTMVACGEDDNVFNCMYEHSIYKSGSRYYDKAYGS
FT                   TYDSDAKVYVLGLIGQFADSRGITSLLRYAQLNKDGSSPAHGWAPQPAKEDLLMLELSY
FT                   RMPIWKGMMSVGGTVSQSEFEVEDKQTDATLFGTYEYRF"
     MMENLKSFGV RAFAILSLFT SFISVSAPWV DTSDIYLRAD IQALADEGVI TVPVNTYPLM        60
     WAGIGADLSK VEPSVLPPSV AQAFARVNYY YRNAVENRGN TRIKAAAATD AARFQHFGSD       120
     YSEQGELQAS YEYMGDRFAF KASASANYDP SDEKEFRYDD SYMAVILGNW IFTAGAVEQW       180
     WGPGFDSSMH RSNNARPLPS VMISRNNAAA FETPWLSWLG PWTLTAGVSR LEEERAVANP       240
     LLWNFRSSLR PFRQLEVGFS WTTQFCGEGE ECSWESALKS ITGQRDCRGA GEAGCTNYGN       300
     QMAGYDIRFS DTWFDIPFGV YYEKTCEDAK GSTPWDIVDC GHAAGVDTRF NFDNAQYKLF       360
     FEYTDTMVAC GEDDNVFNCM YEHSIYKSGS RYYDKAYGST YDSDAKVYVL GLIGQFADSR       420
     GITSLLRYAQ LNKDGSSPAH GWAPQPAKED LLMLELSYRM PIWKGMMSVG GTVSQSEFEV       480
     EDKQTDATLF GTYEYRF                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page