(data stored in ACNUC7421 zone)

EMBL: CP000821.PE118

CP000821.PE118       Location/Qualifiers
FT   CDS             complement(131773..132255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34731"
FT                   /db_xref="GOA:A8FPF8"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF8"
FT                   /protein_id="ABV34731.1"
FT                   /translation="MALSRKKWNNVIIIASLLMITILTLLDDKTSQLPDDAHPLFDNTS
FT                   PLAQLQVNELWLNKGSSNWQCHPKILNCQVWAKAWSEIQLSPLVDQQELFKHSSADTPK
FT                   EVIIVIANSEQAQPWSWYEKLGLLKSPANNWYLIPPSQREGLSPIIKISAASNTDS"
     MALSRKKWNN VIIIASLLMI TILTLLDDKT SQLPDDAHPL FDNTSPLAQL QVNELWLNKG        60
     SSNWQCHPKI LNCQVWAKAW SEIQLSPLVD QQELFKHSSA DTPKEVIIVI ANSEQAQPWS       120
     WYEKLGLLKS PANNWYLIPP SQREGLSPII KISAASNTDS                             160
//

If you have problems or comments...

PBIL Back to PBIL home page