(data stored in ACNUC7421 zone)

EMBL: CP000821.PE119

CP000821.PE119       Location/Qualifiers
FT   CDS             complement(132415..133401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0119"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: slo:Shew_3688 molybdenum cofactor biosynthesis
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34732"
FT                   /db_xref="GOA:A8FPF9"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF9"
FT                   /protein_id="ABV34732.1"
FT                   /translation="MSLIVDTFGRKVEYLRLSVTDRCDFRCVYCMSEDPCFLNREQVLS
FT                   LEELAWVGQAFTELGVRKIRLTGGEPLVRTDCDQLVKLLGDLPGLSELSMTTNGSRLTK
FT                   FAEKMRGSGLGRLNISLDTLKPELFTELTRNGKLERVIEGIDAAKAAGFTRIKINAVIL
FT                   RGQNDDEVLDLIEFCRGRELDIAFIEEMPLGIIDERKKSRHCSSEEVKSIISKRYELSV
FT                   SNKRTGGPARYYTMPGSSIHVGFISPHSNNFCHECNRVRVTVEGRLLLCLGNEHSVDLK
FT                   AILREFPGDIEKLKTAILDAIKLKPKEHVFGPEGDVQILRFMNATGG"
     MSLIVDTFGR KVEYLRLSVT DRCDFRCVYC MSEDPCFLNR EQVLSLEELA WVGQAFTELG        60
     VRKIRLTGGE PLVRTDCDQL VKLLGDLPGL SELSMTTNGS RLTKFAEKMR GSGLGRLNIS       120
     LDTLKPELFT ELTRNGKLER VIEGIDAAKA AGFTRIKINA VILRGQNDDE VLDLIEFCRG       180
     RELDIAFIEE MPLGIIDERK KSRHCSSEEV KSIISKRYEL SVSNKRTGGP ARYYTMPGSS       240
     IHVGFISPHS NNFCHECNRV RVTVEGRLLL CLGNEHSVDL KAILREFPGD IEKLKTAILD       300
     AIKLKPKEHV FGPEGDVQIL RFMNATGG                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page