(data stored in ACNUC7421 zone)

EMBL: CP000821.PE12

CP000821.PE12        Location/Qualifiers
FT   CDS             complement(13485..14171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_I0230 conserved hypothetical protein
FT                   TIGR00370, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34625"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP52"
FT                   /protein_id="ABV34625.1"
FT                   /translation="MTTEQTPKVFRLGEGAVVIDSTNYFPEVSRLSIQRKIWWLADRCR
FT                   QTDEFIDIVPGMNNLTLFVKSNNRINYWLAQLGTLWLQAKEMSLSGRNVEIPLVYGGEF
FT                   GPDLERLAKYHQLSCKEVVRRHSNGKYTVLFLGFQPGFPYLDGLDSSLFTPRLAVPRLS
FT                   IPAGSVGIGGNQTGIYPASAPGGWQLIGRTNMPLFTPESIGSPTLVEPGDTVQFIPVTS
FT                   LVFSAK"
     MTTEQTPKVF RLGEGAVVID STNYFPEVSR LSIQRKIWWL ADRCRQTDEF IDIVPGMNNL        60
     TLFVKSNNRI NYWLAQLGTL WLQAKEMSLS GRNVEIPLVY GGEFGPDLER LAKYHQLSCK       120
     EVVRRHSNGK YTVLFLGFQP GFPYLDGLDS SLFTPRLAVP RLSIPAGSVG IGGNQTGIYP       180
     ASAPGGWQLI GRTNMPLFTP ESIGSPTLVE PGDTVQFIPV TSLVFSAK                    228
//

If you have problems or comments...

PBIL Back to PBIL home page