(data stored in ACNUC7421 zone)

EMBL: CP000821.PE120

CP000821.PE120       Location/Qualifiers
FT   CDS             complement(133479..135284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0120"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="KEGG: slo:Shew_3687 molybdopterin-guanine
FT                   dinucleotide biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34733"
FT                   /db_xref="GOA:A8FPG0"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012182"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG0"
FT                   /protein_id="ABV34733.1"
FT                   /translation="MSIPFTNPLTIPVLGFCAYSGTGKTTLLKKLIPELNRRGVKLAVI
FT                   KHAHHNFDVDIPGKDSYEMRKAGARQMLVASHVRWALMTEDAVGDDPKLPHLLQQIEQD
FT                   SVDIVLVEGFKKLELPKIELHRAAHDKPFIHTHDKNIQAIACCDETELPGDLRRLDIND
FT                   VAQIADFVIEYANNWQPASVNLPLSPAPECGCEVDTSKTLSVRQGIDKILSYVNPITAG
FT                   EVLPLDELNSRVLAEDAISPVDVPQQTNSAMDGYAFKHSSPMLASYKIVADVMAGHQYS
FT                   KVLQTGEAVRIMTGATVPAGADTVQMKELATELEGQVSFQGDITLGQHIRLAGEDIAKG
FT                   HTALAANARLQAPEQGLLASLGFGQLPVFKRPRVAIFSTGDEVCQPGEPLQPNCIYDSN
FT                   RFTIKSMVRKLGCEVIDLGIIHDSEDALADALSQAAVDADVVISSGGVSVGDADFIKLA
FT                   LERVGQINFWRINMRPGRPLAFGQIGDSLFFGLPGNPVAVMVSFMQFVQPALRKLAGEN
FT                   SWAPTMVPAITDTGLRSRVGRTEFTRGIYHLGTDGKLHVTTTGAQGSGMLSSMVKGNCF
FT                   IVISEKDDQLNPGDTVYIQPFADLL"
     MSIPFTNPLT IPVLGFCAYS GTGKTTLLKK LIPELNRRGV KLAVIKHAHH NFDVDIPGKD        60
     SYEMRKAGAR QMLVASHVRW ALMTEDAVGD DPKLPHLLQQ IEQDSVDIVL VEGFKKLELP       120
     KIELHRAAHD KPFIHTHDKN IQAIACCDET ELPGDLRRLD INDVAQIADF VIEYANNWQP       180
     ASVNLPLSPA PECGCEVDTS KTLSVRQGID KILSYVNPIT AGEVLPLDEL NSRVLAEDAI       240
     SPVDVPQQTN SAMDGYAFKH SSPMLASYKI VADVMAGHQY SKVLQTGEAV RIMTGATVPA       300
     GADTVQMKEL ATELEGQVSF QGDITLGQHI RLAGEDIAKG HTALAANARL QAPEQGLLAS       360
     LGFGQLPVFK RPRVAIFSTG DEVCQPGEPL QPNCIYDSNR FTIKSMVRKL GCEVIDLGII       420
     HDSEDALADA LSQAAVDADV VISSGGVSVG DADFIKLALE RVGQINFWRI NMRPGRPLAF       480
     GQIGDSLFFG LPGNPVAVMV SFMQFVQPAL RKLAGENSWA PTMVPAITDT GLRSRVGRTE       540
     FTRGIYHLGT DGKLHVTTTG AQGSGMLSSM VKGNCFIVIS EKDDQLNPGD TVYIQPFADL       600
     L                                                                       601
//

If you have problems or comments...

PBIL Back to PBIL home page