(data stored in ACNUC7421 zone)

EMBL: CP000821.PE121

CP000821.PE121       Location/Qualifiers
FT   CDS             complement(135299..135889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0121"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="KEGG: slo:Shew_3686 molybdopterin-guanine
FT                   dinucleotide biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34734"
FT                   /db_xref="GOA:A8FPG1"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPG1"
FT                   /protein_id="ABV34734.1"
FT                   /translation="MSLQIDAVILAGGMARRMGGNDKGLVELQAQPMIKHAIDRIKPQV
FT                   REILINANRNQTRYAEFGYQVISDEDSGYLGPLAGMITAMGQTQAKYLLVVPCDCPLLP
FT                   ADLVERMLSQLEKENADLAVASDGKREQPVVLLLKPELRDSMKAFLDAGERKIDFWYAK
FT                   HNCAVADFSDQPNAFVNVNTPEQKQQLSEAIAK"
     MSLQIDAVIL AGGMARRMGG NDKGLVELQA QPMIKHAIDR IKPQVREILI NANRNQTRYA        60
     EFGYQVISDE DSGYLGPLAG MITAMGQTQA KYLLVVPCDC PLLPADLVER MLSQLEKENA       120
     DLAVASDGKR EQPVVLLLKP ELRDSMKAFL DAGERKIDFW YAKHNCAVAD FSDQPNAFVN       180
     VNTPEQKQQL SEAIAK                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page