(data stored in ACNUC7421 zone)

EMBL: CP000821.PE122

CP000821.PE122       Location/Qualifiers
FT   CDS             complement(135873..136592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0122"
FT                   /product="ABC transporter-related protein"
FT                   /note="KEGG: slo:Shew_3685 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34735"
FT                   /db_xref="GOA:A8FPG2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG2"
FT                   /protein_id="ABV34735.1"
FT                   /translation="MVKLVANNLEMKFGERHIFSVDRLQLSQGQTIHLQGDNGCGKTTL
FT                   MKLLAGLISPSRGAITTEGFEPLPWWRSNALLGKAVYLHQHPYLFDGSVEYNLSYPHPF
FT                   CNMTKQQLSDRTQTAIEMAELTHLKNQAASSLSGGEKQRLAIARAWIMQPKLLMLDEPT
FT                   SNMDRFSQDLVLAMISDLQQLGTGMLISSHQSCVLTSLCNQTWVIENQHIMSSSTADNI
FT                   PASAPINLQEPRYVIAN"
     MVKLVANNLE MKFGERHIFS VDRLQLSQGQ TIHLQGDNGC GKTTLMKLLA GLISPSRGAI        60
     TTEGFEPLPW WRSNALLGKA VYLHQHPYLF DGSVEYNLSY PHPFCNMTKQ QLSDRTQTAI       120
     EMAELTHLKN QAASSLSGGE KQRLAIARAW IMQPKLLMLD EPTSNMDRFS QDLVLAMISD       180
     LQQLGTGMLI SSHQSCVLTS LCNQTWVIEN QHIMSSSTAD NIPASAPINL QEPRYVIAN        239
//

If you have problems or comments...

PBIL Back to PBIL home page