(data stored in ACNUC7421 zone)

EMBL: CP000821.PE123

CP000821.PE123       Location/Qualifiers
FT   CDS             complement(136595..137302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0123"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="KEGG: slo:Shew_3684 binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34736"
FT                   /db_xref="GOA:A8FPG3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG3"
FT                   /protein_id="ABV34736.1"
FT                   /translation="MNEGWLALLQQALGLLFSLDPDVWSIVSVSFSVSFAALGITLLPS
FT                   MILGFMLAFGRFPGRWFVTNLIQTLQSIPTVVIGLLVYLMLTRMGPLGDLRWLFTQKGM
FT                   ILGQMMICAPVLVAMSQAAFTSVDRRAWETSRTLGASWFRGILTVCRELKVPLLMAIVA
FT                   GFSRILTEVGCSMMVGGNIADVTRNIPTAIALETSKGDFAQAIALGLVLLILSLVLNFT
FT                   LGALRGKAEPRSH"
     MNEGWLALLQ QALGLLFSLD PDVWSIVSVS FSVSFAALGI TLLPSMILGF MLAFGRFPGR        60
     WFVTNLIQTL QSIPTVVIGL LVYLMLTRMG PLGDLRWLFT QKGMILGQMM ICAPVLVAMS       120
     QAAFTSVDRR AWETSRTLGA SWFRGILTVC RELKVPLLMA IVAGFSRILT EVGCSMMVGG       180
     NIADVTRNIP TAIALETSKG DFAQAIALGL VLLILSLVLN FTLGALRGKA EPRSH            235
//

If you have problems or comments...

PBIL Back to PBIL home page