(data stored in ACNUC7421 zone)

EMBL: CP000821.PE124

CP000821.PE124       Location/Qualifiers
FT   CDS             complement(137397..138209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0124"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="KEGG: slo:Shew_3683 extracellular solute-binding
FT                   protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34737"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG4"
FT                   /protein_id="ABV34737.1"
FT                   /translation="MLNLKSIFSFALAATLVTGMPAQAEEIIKLATTTSTENSGLLKNL
FT                   LPKFEAESGYKVQVIATGTGKALKLARQGDVDVIMTHAPAAEAKFVDEGFGLLPRGIME
FT                   NDFVILGPKNDPAKIRNSKTVEEAFAKIAESGAIFVSRGDNSGTNMKEMIIWNNAKVDA
FT                   SFAGYKSVGQGMGKTLLMANELQGYTLSDRGTFVAYKAKLDMAIDFDGGQALANPYQIM
FT                   LINPAKYPDLNHKGARAFSDWLIGAEAQGMINSYKVQGEQLFKATYSE"
     MLNLKSIFSF ALAATLVTGM PAQAEEIIKL ATTTSTENSG LLKNLLPKFE AESGYKVQVI        60
     ATGTGKALKL ARQGDVDVIM THAPAAEAKF VDEGFGLLPR GIMENDFVIL GPKNDPAKIR       120
     NSKTVEEAFA KIAESGAIFV SRGDNSGTNM KEMIIWNNAK VDASFAGYKS VGQGMGKTLL       180
     MANELQGYTL SDRGTFVAYK AKLDMAIDFD GGQALANPYQ IMLINPAKYP DLNHKGARAF       240
     SDWLIGAEAQ GMINSYKVQG EQLFKATYSE                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page