(data stored in ACNUC7421 zone)

EMBL: CP000821.PE126

CP000821.PE126       Location/Qualifiers
FT   CDS             139868..141985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0126"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: slo:Shew_3681 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34739"
FT                   /db_xref="GOA:A8FPG6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG6"
FT                   /protein_id="ABV34739.1"
FT                   /translation="MSFFPRIFGINWQQMQAKVRYRILILTLLPILLTLVSLVFITIYW
FT                   NISYTGKQLFMKVKADLTVANNTLISVQKSQEKQLELVMESWEFQNDFRLFDGNKNSYR
FT                   KQIDHLLDSKKQLLNLDFLRLVSVSEAAADPDLRVMLQKVKGDSAYSGLMVLEPKRLAL
FT                   IDPEMVKTASIPLVETPRSQKPTKKVEDRGLLSRSLLPVPDAEGNVAWYLDGGILFNRD
FT                   IRIVDHIRDLVYDKGTLPERSIGTVTIFLDNTRISTNVPLHFFPQGGEVEGRALGSLVS
FT                   EEVKQKVFSQGMLWVDRAFVFNDWFISAYAPLEDVQGKRIGMIYTGFSESPFIHNYLLN
FT                   IIELGTILMLVLLVSGLLVYRGAYSLLQPIERIHHVVKAVQSGRNLRIGSLGLERDNEL
FT                   SNLAEQFDRMLDLLQRRNSQIQAAAEQLEVKVEERTRSLQEKTEELQNNVALLNETRQQ
FT                   LVTNEKLTALGELTAGIAHEINNPTAVILGNMELMKYELGDRAEDVEEEIDLVIQQVGR
FT                   ISTIIRSLLQYSRPGEFNAPLEMHQLTPIIEEMLVLVRHSIQEQKVILNQELNASYPIE
FT                   VNRPQLLQVLINLVVNAAHAMDEEGRIWIRTYDWVQRGEPIGVKIEIEDEGKGIPQEQL
FT                   SRIFDPFYTTRADGTGLGLSLSYGIIKRIGGTIEVSSTVGKGTLFTIGLYHKAKEEQVD
FT                   TPYEGLHFNGH"
     MSFFPRIFGI NWQQMQAKVR YRILILTLLP ILLTLVSLVF ITIYWNISYT GKQLFMKVKA        60
     DLTVANNTLI SVQKSQEKQL ELVMESWEFQ NDFRLFDGNK NSYRKQIDHL LDSKKQLLNL       120
     DFLRLVSVSE AAADPDLRVM LQKVKGDSAY SGLMVLEPKR LALIDPEMVK TASIPLVETP       180
     RSQKPTKKVE DRGLLSRSLL PVPDAEGNVA WYLDGGILFN RDIRIVDHIR DLVYDKGTLP       240
     ERSIGTVTIF LDNTRISTNV PLHFFPQGGE VEGRALGSLV SEEVKQKVFS QGMLWVDRAF       300
     VFNDWFISAY APLEDVQGKR IGMIYTGFSE SPFIHNYLLN IIELGTILML VLLVSGLLVY       360
     RGAYSLLQPI ERIHHVVKAV QSGRNLRIGS LGLERDNELS NLAEQFDRML DLLQRRNSQI       420
     QAAAEQLEVK VEERTRSLQE KTEELQNNVA LLNETRQQLV TNEKLTALGE LTAGIAHEIN       480
     NPTAVILGNM ELMKYELGDR AEDVEEEIDL VIQQVGRIST IIRSLLQYSR PGEFNAPLEM       540
     HQLTPIIEEM LVLVRHSIQE QKVILNQELN ASYPIEVNRP QLLQVLINLV VNAAHAMDEE       600
     GRIWIRTYDW VQRGEPIGVK IEIEDEGKGI PQEQLSRIFD PFYTTRADGT GLGLSLSYGI       660
     IKRIGGTIEV SSTVGKGTLF TIGLYHKAKE EQVDTPYEGL HFNGH                       705
//

If you have problems or comments...

PBIL Back to PBIL home page