(data stored in ACNUC7421 zone)

EMBL: CP000821.PE128

CP000821.PE128       Location/Qualifiers
FT   CDS             complement(142834..143499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34741"
FT                   /db_xref="GOA:A8FPG8"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG8"
FT                   /protein_id="ABV34741.1"
FT                   /translation="MLTLTNAQIRRALLVLVGFHILIICASNYLVQLPFQIFELHTTWG
FT                   AFSFPFVYLATDLTVRIFGQSAARRIILKAMIPALLISYLMGVIFHQGSFQGFTALSEF
FT                   NNFVFRIAFASFAAYLIGQLMDITVFAKLRNTQSWWVAPAASTLIGNLVDTLVFFSLAF
FT                   YASSDSFMAAHWPEIASVDYGFKLIVSLGLFLPAYGVLLKVLERKIVKLPTQQELATN"
     MLTLTNAQIR RALLVLVGFH ILIICASNYL VQLPFQIFEL HTTWGAFSFP FVYLATDLTV        60
     RIFGQSAARR IILKAMIPAL LISYLMGVIF HQGSFQGFTA LSEFNNFVFR IAFASFAAYL       120
     IGQLMDITVF AKLRNTQSWW VAPAASTLIG NLVDTLVFFS LAFYASSDSF MAAHWPEIAS       180
     VDYGFKLIVS LGLFLPAYGV LLKVLERKIV KLPTQQELAT N                           221
//

If you have problems or comments...

PBIL Back to PBIL home page