(data stored in ACNUC7421 zone)

EMBL: CP000821.PE129

CP000821.PE129       Location/Qualifiers
FT   CDS             143796..144581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34742"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG9"
FT                   /protein_id="ABV34742.1"
FT                   /translation="MVISMKRLTLTTLLICLILLPSHLLANPTPLIEGPRVVTIATDSW
FT                   LGYTNRDGSGYYFDILKRVFPEKEWLLQIDIVPFSRVRYLVNHNRIDMALGFYSGDTTR
FT                   ALYSKNPVEVDSVDAAITPELAVIWKGAESLSQKKVQALLAYRYDEFISVPMYYEESSN
FT                   LLEMLNRVNRGQVDAVLDYKPVMLTMVPKLNQPRQFVIIENVFRTEIYFVFSDNDRGAK
FT                   LKRHFDRELKKLIDSGELDELFRHYVGPDAQRLDPGREQ"
     MVISMKRLTL TTLLICLILL PSHLLANPTP LIEGPRVVTI ATDSWLGYTN RDGSGYYFDI        60
     LKRVFPEKEW LLQIDIVPFS RVRYLVNHNR IDMALGFYSG DTTRALYSKN PVEVDSVDAA       120
     ITPELAVIWK GAESLSQKKV QALLAYRYDE FISVPMYYEE SSNLLEMLNR VNRGQVDAVL       180
     DYKPVMLTMV PKLNQPRQFV IIENVFRTEI YFVFSDNDRG AKLKRHFDRE LKKLIDSGEL       240
     DELFRHYVGP DAQRLDPGRE Q                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page