(data stored in ACNUC7421 zone)

EMBL: CP000821.PE13

CP000821.PE13        Location/Qualifiers
FT   CDS             14650..15705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0013"
FT                   /product="putative signal transduction protein"
FT                   /note="KEGG: sbl:Sbal_0011 putative signal transduction
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34626"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP53"
FT                   /protein_id="ABV34626.1"
FT                   /translation="MVIKLFQKIFNIRDNAVVSQPKSFSQNPELQQISSNKPKASLEPL
FT                   SAVEDSVDVSALFYSLLFPARQKDQGGVANNLEKNVIGDVERALSSPMAIAENVLKLPT
FT                   RMAELNKKLGDESVDIKVLLELMQKDPVLSVEVLKLCNSPVFKRSEREVTSLQQAFVQL
FT                   GRDQLRRFVTTSLVREMIEIKPIYYRRFGLQIWRHSMQVAFLSSELAGELSNDDPDTAF
FT                   MLGLLHDVGKIAIFKMLLDEFNLADPGEQPCSSLFRQVMTSKSLSLSALLARCWQLPAS
FT                   FEVTLNALANTSAKPTERLAAVVWRANLISECSMLHQAGKLDEFGLNRLLIDADLTREE
FT                   FDLFHEKLKEF"
     MVIKLFQKIF NIRDNAVVSQ PKSFSQNPEL QQISSNKPKA SLEPLSAVED SVDVSALFYS        60
     LLFPARQKDQ GGVANNLEKN VIGDVERALS SPMAIAENVL KLPTRMAELN KKLGDESVDI       120
     KVLLELMQKD PVLSVEVLKL CNSPVFKRSE REVTSLQQAF VQLGRDQLRR FVTTSLVREM       180
     IEIKPIYYRR FGLQIWRHSM QVAFLSSELA GELSNDDPDT AFMLGLLHDV GKIAIFKMLL       240
     DEFNLADPGE QPCSSLFRQV MTSKSLSLSA LLARCWQLPA SFEVTLNALA NTSAKPTERL       300
     AAVVWRANLI SECSMLHQAG KLDEFGLNRL LIDADLTREE FDLFHEKLKE F                351
//

If you have problems or comments...

PBIL Back to PBIL home page