(data stored in ACNUC7421 zone)

EMBL: CP000821.PE131

CP000821.PE131       Location/Qualifiers
FT   CDS             146463..148496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0131"
FT                   /product="TonB-dependent receptor, plug"
FT                   /note="KEGG: sbl:Sbal_0089 TonB-dependent receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34744"
FT                   /db_xref="GOA:A8FPH1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH1"
FT                   /protein_id="ABV34744.1"
FT                   /translation="MKVQQKIIKMSAIALAIGSSGAVFADDIDRDPILNVNEVIVVHGE
FT                   RPTATEVATTHWSIDEDEIKALGAQSLEQVLKNVPGVYVRTGGQGTPRVDIRGFKTRHV
FT                   TLLINGVPANGAEDGQFDPSVIPTSQIASVEVSVGPTSVLYGPGGAGGVINIITKQGDD
FT                   ASTLSGRLEASGEDTFNGDISAAGSGDNWQGLVSVSHQQTNGFPLSGDYPHNDVQLDDV
FT                   RANSDKEIDNIYAQGSYWLSDNTQVTANMSLRSGQWGKPSRDGSGSGTVKFERADDYDA
FT                   KTFQLGMAHKFSEMFTLRGFGYHNQSDVLETQYTDSSYTKVKQSQDGRSKVQGGNLQFI
FT                   TNFGDVGLLTSSLIAENQSWESTTSKPSTGDKSSQKQSRVLDGYSGGSGGGNGGGSSNF
FT                   DDSAWLYTLAAEYQYQDDGYYGFTIGGALHDQDRVKESENDYSGQLSGFWQAFEQTRFN
FT                   AGIARKVRFPSMKNLYSQSSGNADLVAETSKHFELGVEQELGASTALSVAGYYTDAENY
FT                   IAKDMSGVYQNMGRYQFKGVDVSLNNQFIDDLSLTFVYSFLDTEDKDAFDGMGTLEYRP
FT                   RHQLRFQADYELPFAMRINMNIERIMGQVYYEQEKVNGNKVWTEQSLKDYTLLDLNLVQ
FT                   PVLDDKLELYIRATNLLDENYYQSDAIPQAGRQVFVGISWQI"
     MKVQQKIIKM SAIALAIGSS GAVFADDIDR DPILNVNEVI VVHGERPTAT EVATTHWSID        60
     EDEIKALGAQ SLEQVLKNVP GVYVRTGGQG TPRVDIRGFK TRHVTLLING VPANGAEDGQ       120
     FDPSVIPTSQ IASVEVSVGP TSVLYGPGGA GGVINIITKQ GDDASTLSGR LEASGEDTFN       180
     GDISAAGSGD NWQGLVSVSH QQTNGFPLSG DYPHNDVQLD DVRANSDKEI DNIYAQGSYW       240
     LSDNTQVTAN MSLRSGQWGK PSRDGSGSGT VKFERADDYD AKTFQLGMAH KFSEMFTLRG       300
     FGYHNQSDVL ETQYTDSSYT KVKQSQDGRS KVQGGNLQFI TNFGDVGLLT SSLIAENQSW       360
     ESTTSKPSTG DKSSQKQSRV LDGYSGGSGG GNGGGSSNFD DSAWLYTLAA EYQYQDDGYY       420
     GFTIGGALHD QDRVKESEND YSGQLSGFWQ AFEQTRFNAG IARKVRFPSM KNLYSQSSGN       480
     ADLVAETSKH FELGVEQELG ASTALSVAGY YTDAENYIAK DMSGVYQNMG RYQFKGVDVS       540
     LNNQFIDDLS LTFVYSFLDT EDKDAFDGMG TLEYRPRHQL RFQADYELPF AMRINMNIER       600
     IMGQVYYEQE KVNGNKVWTE QSLKDYTLLD LNLVQPVLDD KLELYIRATN LLDENYYQSD       660
     AIPQAGRQVF VGISWQI                                                      677
//

If you have problems or comments...

PBIL Back to PBIL home page