(data stored in ACNUC7421 zone)

EMBL: CP000821.PE133

CP000821.PE133       Location/Qualifiers
FT   CDS             150025..150717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0133"
FT                   /product="cobalt transport protein"
FT                   /note="KEGG: sbl:Sbal_0091 cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34746"
FT                   /db_xref="GOA:A8FPH3"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH3"
FT                   /protein_id="ABV34746.1"
FT                   /translation="MRAKGRHKATEYRGAAGFDHHRLERAAARKSGYITATSLILVLLL
FT                   SSGAFFLPDRYIPGLIACEICLVIHGVYRRGSLGVIARVFFVQLTITMSLYYLIHGQSQ
FT                   LAQGAVAVLRILLAFIPGWWLSITCAPERIGEVLTWVLPVKWAFVIAASISLLPYMTVE
FT                   LREIYHIQCLRGARINPKALRDPRNWSELINCVIFPVLIQLLKLSRQIAVAAQLRYFGK
FT                   SNQPTHWR"
     MRAKGRHKAT EYRGAAGFDH HRLERAAARK SGYITATSLI LVLLLSSGAF FLPDRYIPGL        60
     IACEICLVIH GVYRRGSLGV IARVFFVQLT ITMSLYYLIH GQSQLAQGAV AVLRILLAFI       120
     PGWWLSITCA PERIGEVLTW VLPVKWAFVI AASISLLPYM TVELREIYHI QCLRGARINP       180
     KALRDPRNWS ELINCVIFPV LIQLLKLSRQ IAVAAQLRYF GKSNQPTHWR                  230
//

If you have problems or comments...

PBIL Back to PBIL home page