(data stored in ACNUC7421 zone)

EMBL: CP000821.PE134

CP000821.PE134       Location/Qualifiers
FT   CDS             150785..151330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34747"
FT                   /db_xref="GOA:A8FPH4"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH4"
FT                   /protein_id="ABV34747.1"
FT                   /translation="MSKSFNFSLQDALFIGFCATLLVALKSMLRLKLGISGHSMFLMTF
FT                   FYLICYGVVGRVGCISACGVLSGLVAMILSVGKGGPLILIKFALPAIAMDLSLLVFAGL
FT                   FTLRWRCVIVGLIGCLAWATKGWIEDLLVGMTMQVALVQFALSMLKGGMFTLFAALMVP
FT                   PVLERLKSHDLLYKESAK"
     MSKSFNFSLQ DALFIGFCAT LLVALKSMLR LKLGISGHSM FLMTFFYLIC YGVVGRVGCI        60
     SACGVLSGLV AMILSVGKGG PLILIKFALP AIAMDLSLLV FAGLFTLRWR CVIVGLIGCL       120
     AWATKGWIED LLVGMTMQVA LVQFALSMLK GGMFTLFAAL MVPPVLERLK SHDLLYKESA       180
     K                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page