(data stored in ACNUC7421 zone)

EMBL: CP000821.PE135

CP000821.PE135       Location/Qualifiers
FT   CDS             151331..152086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34748"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH5"
FT                   /protein_id="ABV34748.1"
FT                   /translation="MNNKQLKSWLICIDDTDDIGTKGTGEIAQEIAEILSGDEHESCSF
FT                   ITRHQLYVHPDIPYTSHNSAMCFYLETNKSLAMIEQLAIAHLLEESAPASDPGLAILAC
FT                   DSGFDREALIHFGLEAKGQVKTKQDAYDLAMRLGVSLSEHGGTGQGVIGALAGIGLRLY
FT                   GQDGRVKGQIDLGQELYEEGVELTVEEVLTRSGLDIVVDLSGQQLKSTEVIHLTKKVKA
FT                   VYCQHQFALLVYRHEGRWCNALKRQLKEY"
     MNNKQLKSWL ICIDDTDDIG TKGTGEIAQE IAEILSGDEH ESCSFITRHQ LYVHPDIPYT        60
     SHNSAMCFYL ETNKSLAMIE QLAIAHLLEE SAPASDPGLA ILACDSGFDR EALIHFGLEA       120
     KGQVKTKQDA YDLAMRLGVS LSEHGGTGQG VIGALAGIGL RLYGQDGRVK GQIDLGQELY       180
     EEGVELTVEE VLTRSGLDIV VDLSGQQLKS TEVIHLTKKV KAVYCQHQFA LLVYRHEGRW       240
     CNALKRQLKE Y                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page