(data stored in ACNUC7421 zone)

EMBL: CP000821.PE137

CP000821.PE137       Location/Qualifiers
FT   CDS             152571..153749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0137"
FT                   /product="HD domain protein"
FT                   /note="KEGG: son:SO4711 HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34750"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH7"
FT                   /protein_id="ABV34750.1"
FT                   /translation="MADSVESKALVKFPVSKLTVGMFVTAIDRQGLVKISNAGQIRHRD
FT                   AIAKLVKNGIKHVWVDAERSAEHCGLKRAPSPKPVGKKPQQSREKSQKQAKKLIVEAKD
FT                   LVKKVLSETFEGKAIEVAPFGALADNMIESALLDADALKCVSALRTKDAYLLEHSINVA
FT                   FLLVTFGKYLKLEKDTLRQMAIGGMLHDIGKIKVDDKVLNKPGRLTPEEFEHIKLHQVF
FT                   AIDIMKETKGLSSISKDVCLMHHEKLDGNGYPKGLKGDELPLHGRMSCIVDIFDALTAT
FT                   RCYKEAMSPAAAFKVLLSLTPSHLDRALVYEFIRCVGVYPVGSLVELSDGRIGIVWQAS
FT                   NRDALHPILKCFYSIKHKRYTEVAMVDLLKSDLHIERGVSPSSLDVDPSPFY"
     MADSVESKAL VKFPVSKLTV GMFVTAIDRQ GLVKISNAGQ IRHRDAIAKL VKNGIKHVWV        60
     DAERSAEHCG LKRAPSPKPV GKKPQQSREK SQKQAKKLIV EAKDLVKKVL SETFEGKAIE       120
     VAPFGALADN MIESALLDAD ALKCVSALRT KDAYLLEHSI NVAFLLVTFG KYLKLEKDTL       180
     RQMAIGGMLH DIGKIKVDDK VLNKPGRLTP EEFEHIKLHQ VFAIDIMKET KGLSSISKDV       240
     CLMHHEKLDG NGYPKGLKGD ELPLHGRMSC IVDIFDALTA TRCYKEAMSP AAAFKVLLSL       300
     TPSHLDRALV YEFIRCVGVY PVGSLVELSD GRIGIVWQAS NRDALHPILK CFYSIKHKRY       360
     TEVAMVDLLK SDLHIERGVS PSSLDVDPSP FY                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page