(data stored in ACNUC7421 zone)

EMBL: CP000821.PE138

CP000821.PE138       Location/Qualifiers
FT   CDS             153896..154564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0138"
FT                   /product="paraquat-inducible protein A"
FT                   /note="KEGG: sbl:Sbal_0097 paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34751"
FT                   /db_xref="GOA:A8FPH8"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH8"
FT                   /protein_id="ABV34751.1"
FT                   /translation="MHRVLPIIVIFISLALLVPGVTQPILSLSGTIDKSELTLAGVDHL
FT                   ANSFSDDSAGSGSARGMISMITGMLGLNEIEGEVEVFQKTRSILGTIEELFQSGNAPVS
FT                   ALVMLFSIVIPALKLSVMLFLQFSVPEKVERHLNRFIALISKWSMADVFVVALMVSFMA
FT                   GNASAGMGELLRTTAKFEVGFYYFTAYCIFSILSTYLVTRRRRANTTGVEREAVLTSPQ
FT                   "
     MHRVLPIIVI FISLALLVPG VTQPILSLSG TIDKSELTLA GVDHLANSFS DDSAGSGSAR        60
     GMISMITGML GLNEIEGEVE VFQKTRSILG TIEELFQSGN APVSALVMLF SIVIPALKLS       120
     VMLFLQFSVP EKVERHLNRF IALISKWSMA DVFVVALMVS FMAGNASAGM GELLRTTAKF       180
     EVGFYYFTAY CIFSILSTYL VTRRRRANTT GVEREAVLTS PQ                          222
//

If you have problems or comments...

PBIL Back to PBIL home page