(data stored in ACNUC7421 zone)

EMBL: CP000821.PE139

CP000821.PE139       Location/Qualifiers
FT   CDS             complement(154595..157789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0139"
FT                   /product="Histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: neu:NE0049 sensory transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34752"
FT                   /db_xref="GOA:A8FPH9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH9"
FT                   /protein_id="ABV34752.1"
FT                   /translation="MPFRLLTQWLSLTSIGSKVILSMAGISLLVLMLSASNFIMNTRVK
FT                   EDTTEVSTHEIPKAIAAINMLDEIGDMNSNILEYVLGEVDERDDFDQNQITFLQYLATL
FT                   KSALKAHDRRIDEIEELFNDFHTSARANVFNRYNPNNEAWAKQRVDGLTNVTGHKLEVL
FT                   LDSLKESEIKDVGSQPDLNEVIHDDLPGVRYYLELVDEAGDMTANLTEYISGIYEAKNA
FT                   FIENAQDFEEYLTKLQPLEQKPEEIALLAEVEALYKVLRDGGFEVFQRYNSSNKLEAIT
FT                   AIDELEHQTFARLERLLDDVSIDAERNTNLELLGLRQMTISNQYVLIVSLFLVLSLCIS
FT                   IIYFSYRIITRPITKLSSTMKQLADGDTEVDVVYRDRQDEVGNMAQAVEVFKTNMIARN
FT                   AAEQELVMAKDNAEAASKAKASFLATMSHEIRTPMNGIIGMIDLLLTSSLNRDQRSMTN
FT                   TIRDSSFSLLNIINDILDFSKIEAGKLELESLNFSISELLESVIDTITPNADEKRVTLE
FT                   LYTDPNIPHHIQGDPVRIRQVLFNLVGNAVKFSAVQDSRGEVRITLKKKELSNQLVFLT
FT                   IEIQDNGIGIEAKQLERLFQPFTQAESSTTRQFGGTGLGLAICQNLVNLMGGKIDVSST
FT                   VGKGSIFKVNLSFPYIERPSPLTHDYPKVIVIDDIHSEPLSVRVKEYLSSREVNLVSMP
FT                   YMNTSDHLRDNVETWAQVVIATDQLEQSRQQVEQNLTDAERKNIRFLVLKPTSRGDGII
FT                   DDNTFSIAASPLKISTLFYGLHVALGRESPLDSSAHEADTLSHTPLSITDAEKAGRLIL
FT                   VAEDNQTNQEVIKRQLSKLGYSCIVADDGVHAEELYPTYKFAMVLTDCHMPRRDGYELT
FT                   RVLRSMQKKSGIKVPIIAITANALVGESEKCIAAGMDDYLSKPVELVKLNKMLKKWLSS
FT                   SFKNSNDADKEQTDTERRYLDQGVISLVFADDREDYIAALSDFMEIILPQMKSMVKERN
FT                   FNISAIGELAHKLKSSAKTIGLLSIGDHCETIEAIAKEPDNQQARVSITERLDSIEDLL
FT                   PQIEKEITDVISSACR"
     MPFRLLTQWL SLTSIGSKVI LSMAGISLLV LMLSASNFIM NTRVKEDTTE VSTHEIPKAI        60
     AAINMLDEIG DMNSNILEYV LGEVDERDDF DQNQITFLQY LATLKSALKA HDRRIDEIEE       120
     LFNDFHTSAR ANVFNRYNPN NEAWAKQRVD GLTNVTGHKL EVLLDSLKES EIKDVGSQPD       180
     LNEVIHDDLP GVRYYLELVD EAGDMTANLT EYISGIYEAK NAFIENAQDF EEYLTKLQPL       240
     EQKPEEIALL AEVEALYKVL RDGGFEVFQR YNSSNKLEAI TAIDELEHQT FARLERLLDD       300
     VSIDAERNTN LELLGLRQMT ISNQYVLIVS LFLVLSLCIS IIYFSYRIIT RPITKLSSTM       360
     KQLADGDTEV DVVYRDRQDE VGNMAQAVEV FKTNMIARNA AEQELVMAKD NAEAASKAKA       420
     SFLATMSHEI RTPMNGIIGM IDLLLTSSLN RDQRSMTNTI RDSSFSLLNI INDILDFSKI       480
     EAGKLELESL NFSISELLES VIDTITPNAD EKRVTLELYT DPNIPHHIQG DPVRIRQVLF       540
     NLVGNAVKFS AVQDSRGEVR ITLKKKELSN QLVFLTIEIQ DNGIGIEAKQ LERLFQPFTQ       600
     AESSTTRQFG GTGLGLAICQ NLVNLMGGKI DVSSTVGKGS IFKVNLSFPY IERPSPLTHD       660
     YPKVIVIDDI HSEPLSVRVK EYLSSREVNL VSMPYMNTSD HLRDNVETWA QVVIATDQLE       720
     QSRQQVEQNL TDAERKNIRF LVLKPTSRGD GIIDDNTFSI AASPLKISTL FYGLHVALGR       780
     ESPLDSSAHE ADTLSHTPLS ITDAEKAGRL ILVAEDNQTN QEVIKRQLSK LGYSCIVADD       840
     GVHAEELYPT YKFAMVLTDC HMPRRDGYEL TRVLRSMQKK SGIKVPIIAI TANALVGESE       900
     KCIAAGMDDY LSKPVELVKL NKMLKKWLSS SFKNSNDADK EQTDTERRYL DQGVISLVFA       960
     DDREDYIAAL SDFMEIILPQ MKSMVKERNF NISAIGELAH KLKSSAKTIG LLSIGDHCET      1020
     IEAIAKEPDN QQARVSITER LDSIEDLLPQ IEKEITDVIS SACR                       1064
//

If you have problems or comments...

PBIL Back to PBIL home page