(data stored in ACNUC7421 zone)

EMBL: CP000821.PE140

CP000821.PE140       Location/Qualifiers
FT   CDS             158116..158796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0140"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="KEGG: slo:Shew_3669 ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34753"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI0"
FT                   /protein_id="ABV34753.1"
FT                   /translation="MKRRDFLAAGTLAMATAMVSPQLFAATEDKPLQILALVFDDYETL
FT                   DLHGPVEMLGHMKNVQIKLVGDKSIIRSYQGPKVVTDISMDSVTPCDLFIVPGGLGTRK
FT                   LVEDEELMAWLRKQVSVSGKVFSICTGSALLAKAGILDGVNATTNKMAYQWVTGLAGQV
FT                   NWQPSARWVDDGKFLTSSGVSAGTDAALFYVSQLRGEVEARRIERLTEYHWNHDAKNDP
FT                   YAVS"
     MKRRDFLAAG TLAMATAMVS PQLFAATEDK PLQILALVFD DYETLDLHGP VEMLGHMKNV        60
     QIKLVGDKSI IRSYQGPKVV TDISMDSVTP CDLFIVPGGL GTRKLVEDEE LMAWLRKQVS       120
     VSGKVFSICT GSALLAKAGI LDGVNATTNK MAYQWVTGLA GQVNWQPSAR WVDDGKFLTS       180
     SGVSAGTDAA LFYVSQLRGE VEARRIERLT EYHWNHDAKN DPYAVS                      226
//

If you have problems or comments...

PBIL Back to PBIL home page