(data stored in ACNUC7421 zone)

EMBL: CP000821.PE141

CP000821.PE141       Location/Qualifiers
FT   CDS             complement(159371..160315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_3868 conserved hypothetical
FT                   protein 698"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34754"
FT                   /db_xref="GOA:A8FPI1"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI1"
FT                   /protein_id="ABV34754.1"
FT                   /translation="MKLGTISFQTVKRHLPFFLIAVLCLLPVISSPIALVLGFTLASLG
FT                   LIPDEIDLGKSTKRLLSYSIIGLGFGIQLQTAISASMQNLPLILGSIIFTLLLGFILTK
FT                   ALKFDTKTGHLISAGTAICGGSAIAAVAPAINAKSEQSAIALATVFILNSVALFLFPAL
FT                   GHLFSMSQYDFGVWSAIAIHDTSSVVGAASAYGEEALTTATTIKLARALWIIPIALLSA
FT                   MAFGGDKKRITIPYFIGFYCLAIAIAHYFPQGQAVYEVLFELSKRVLVLCLFLIGAGIT
FT                   VRKMRAAGPKPLLLGVLLWLSIGTSSLLYILYL"
     MKLGTISFQT VKRHLPFFLI AVLCLLPVIS SPIALVLGFT LASLGLIPDE IDLGKSTKRL        60
     LSYSIIGLGF GIQLQTAISA SMQNLPLILG SIIFTLLLGF ILTKALKFDT KTGHLISAGT       120
     AICGGSAIAA VAPAINAKSE QSAIALATVF ILNSVALFLF PALGHLFSMS QYDFGVWSAI       180
     AIHDTSSVVG AASAYGEEAL TTATTIKLAR ALWIIPIALL SAMAFGGDKK RITIPYFIGF       240
     YCLAIAIAHY FPQGQAVYEV LFELSKRVLV LCLFLIGAGI TVRKMRAAGP KPLLLGVLLW       300
     LSIGTSSLLY ILYL                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page