(data stored in ACNUC7421 zone)

EMBL: CP000821.PE143

CP000821.PE143       Location/Qualifiers
FT   CDS             complement(162024..162545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_4053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34756"
FT                   /db_xref="GOA:A8FPI3"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI3"
FT                   /protein_id="ABV34756.1"
FT                   /translation="MSLLTQYTWFIKLATVASFSIIISVSTVSYSRADTKEPLPLGVVL
FT                   DSEGNPISLPSRNQSALEFHSPTITKPHHNPGVNPVPNKRTSKKKARSKKLSRKQQLTS
FT                   RAQIANDPSCRWLNSRMNKLEESLTSVGNRSANSYHKKELAVRNKEWKCMKCGAEGPEQ
FT                   KDYDRCQYRR"
     MSLLTQYTWF IKLATVASFS IIISVSTVSY SRADTKEPLP LGVVLDSEGN PISLPSRNQS        60
     ALEFHSPTIT KPHHNPGVNP VPNKRTSKKK ARSKKLSRKQ QLTSRAQIAN DPSCRWLNSR       120
     MNKLEESLTS VGNRSANSYH KKELAVRNKE WKCMKCGAEG PEQKDYDRCQ YRR              173
//

If you have problems or comments...

PBIL Back to PBIL home page