(data stored in ACNUC7421 zone)

EMBL: CP000821.PE144

CP000821.PE144       Location/Qualifiers
FT   CDS             complement(162665..163441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34757"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI4"
FT                   /protein_id="ABV34757.1"
FT                   /translation="MNNKFKFSLLTSLLITASTVYADTSANIDDSHSRNILPANEAVDT
FT                   NYLLDLGWDSKYVSEGRNNLDKGGIFWGTAAVQHGNLNVYATLGRADDQDYTEWNFGLE
FT                   YAIALSDTLEATVGYQRLEFYGDERANDNEFFSSLTYSGIKWLTPSIAYTYATEAGGYF
FT                   VEASLHSSWELLENFTVTPYVTQAFDFQYATEDHDGPNHFQFGLEAEYLVNDQIVLSGH
FT                   VSHTIAQEDIKAEAKADGIEGSLDQTYAGVHLTWNF"
     MNNKFKFSLL TSLLITASTV YADTSANIDD SHSRNILPAN EAVDTNYLLD LGWDSKYVSE        60
     GRNNLDKGGI FWGTAAVQHG NLNVYATLGR ADDQDYTEWN FGLEYAIALS DTLEATVGYQ       120
     RLEFYGDERA NDNEFFSSLT YSGIKWLTPS IAYTYATEAG GYFVEASLHS SWELLENFTV       180
     TPYVTQAFDF QYATEDHDGP NHFQFGLEAE YLVNDQIVLS GHVSHTIAQE DIKAEAKADG       240
     IEGSLDQTYA GVHLTWNF                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page