(data stored in ACNUC7421 zone)

EMBL: CP000821.PE146

CP000821.PE146       Location/Qualifiers
FT   CDS             complement(165926..166345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34759"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI6"
FT                   /protein_id="ABV34759.1"
FT                   /translation="MKSIFSIFVLFISLSTLTACATSRPTSITVDDSDRLVEIKVSGNF
FT                   LEDELRFKSAKYDIRIQNLGDNLFHIDAKVISKRIDHLTGDELIASNQIVTQVKAEPEE
FT                   KVTIGGLDSWSESIQEDGSVIETRAEKRYVLQIMN"
     MKSIFSIFVL FISLSTLTAC ATSRPTSITV DDSDRLVEIK VSGNFLEDEL RFKSAKYDIR        60
     IQNLGDNLFH IDAKVISKRI DHLTGDELIA SNQIVTQVKA EPEEKVTIGG LDSWSESIQE       120
     DGSVIETRAE KRYVLQIMN                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page