(data stored in ACNUC7421 zone)

EMBL: CP000821.PE147

CP000821.PE147       Location/Qualifiers
FT   CDS             166663..167193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34760"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI7"
FT                   /protein_id="ABV34760.1"
FT                   /translation="MNLYFRLFWLFIWRVRHCNSIDFLGTSRISYRALPLDCDINCHVT
FT                   NSRYPALMDLARTYMLAEMGLLKRFIKLKWLPIVNAAEFTYIRDIKPLTKFEIESKLVG
FT                   WDDKYFYIEQRFVSDNILHCIVHVRGVFVCKGKQVPIDTMVKEVNFEGPRPELPPEVVK
FT                   WKAFLQLKKERNI"
     MNLYFRLFWL FIWRVRHCNS IDFLGTSRIS YRALPLDCDI NCHVTNSRYP ALMDLARTYM        60
     LAEMGLLKRF IKLKWLPIVN AAEFTYIRDI KPLTKFEIES KLVGWDDKYF YIEQRFVSDN       120
     ILHCIVHVRG VFVCKGKQVP IDTMVKEVNF EGPRPELPPE VVKWKAFLQL KKERNI           176
//

If you have problems or comments...

PBIL Back to PBIL home page