(data stored in ACNUC7421 zone)

EMBL: CP000821.PE151

CP000821.PE151       Location/Qualifiers
FT   CDS             complement(170152..170910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34764"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ1"
FT                   /protein_id="ABV34764.1"
FT                   /translation="MRTMTIQMKLQHKILLGGLLLSAASFAQAENEGEVLGGTISGNLT
FT                   FASDYVFRGESETMDGDVPVVQGTLGWGNDDGWYGGVFASNIKFADPNLEIVTAPYIGK
FT                   AGEFGDSGITYDVMVFSYLYPGASYSNYTELWMKVGKQFGQANIQLEVTPTIDDWFGVD
FT                   GWQGVNYSIHPSYAFKNGLKVSGSVGYQDLDGDNAEGWGHWNLGVSKAFYGLNFDLRYH
FT                   GSTVDETHKVYGTQTEIFDDRVVIGINKSF"
     MRTMTIQMKL QHKILLGGLL LSAASFAQAE NEGEVLGGTI SGNLTFASDY VFRGESETMD        60
     GDVPVVQGTL GWGNDDGWYG GVFASNIKFA DPNLEIVTAP YIGKAGEFGD SGITYDVMVF       120
     SYLYPGASYS NYTELWMKVG KQFGQANIQL EVTPTIDDWF GVDGWQGVNY SIHPSYAFKN       180
     GLKVSGSVGY QDLDGDNAEG WGHWNLGVSK AFYGLNFDLR YHGSTVDETH KVYGTQTEIF       240
     DDRVVIGINK SF                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page