(data stored in ACNUC7421 zone)

EMBL: CP000821.PE152

CP000821.PE152       Location/Qualifiers
FT   CDS             171346..172503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0152"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: slo:Shew_0031 efflux transporter, RND family,
FT                   MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34765"
FT                   /db_xref="GOA:A8FPJ2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ2"
FT                   /protein_id="ABV34765.1"
FT                   /translation="MRQIVKIASVLSVALWITACGQKPEQGPQERGPMEVGVIKVEAQP
FT                   QSILVELPGRSKAYLEAEVRPQVSGIIMTRGFVEGRDVEKGQSLYQIDSSTYTAALISA
FT                   KADLQSAKANLVSAKAKALRFEKLVKLNSISEQDYDEADAAYKAALARVTVAEAAINTA
FT                   KINLEYTEVRAPIAGRVGKSSVTAGALVTANQTQTLATIQQLDPINIEIAQSSAQMLRL
FT                   KSKLKQGQLKAADNAGVQLILEDGTTYKHDGVLQFAEVSVNEDTGSVILRAEFPNPDGV
FT                   LMPGMYVRAVLNTGTDPEAILVPQRAITRNTKGEAVAMIIDAEGKVAARVVTTAEVIDH
FT                   QWRITDGLTVGDQLIVEGLQKIRPGAAVKAGPLVADKKSQAQQQK"
     MRQIVKIASV LSVALWITAC GQKPEQGPQE RGPMEVGVIK VEAQPQSILV ELPGRSKAYL        60
     EAEVRPQVSG IIMTRGFVEG RDVEKGQSLY QIDSSTYTAA LISAKADLQS AKANLVSAKA       120
     KALRFEKLVK LNSISEQDYD EADAAYKAAL ARVTVAEAAI NTAKINLEYT EVRAPIAGRV       180
     GKSSVTAGAL VTANQTQTLA TIQQLDPINI EIAQSSAQML RLKSKLKQGQ LKAADNAGVQ       240
     LILEDGTTYK HDGVLQFAEV SVNEDTGSVI LRAEFPNPDG VLMPGMYVRA VLNTGTDPEA       300
     ILVPQRAITR NTKGEAVAMI IDAEGKVAAR VVTTAEVIDH QWRITDGLTV GDQLIVEGLQ       360
     KIRPGAAVKA GPLVADKKSQ AQQQK                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page