(data stored in ACNUC7421 zone)

EMBL: CP000821.PE154

CP000821.PE154       Location/Qualifiers
FT   CDS             complement(175802..176479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0154"
FT                   /product="glutathione S-transferase, C-terminal domain
FT                   protein"
FT                   /note="KEGG: sfr:Sfri_2500 glutathione S-transferase,
FT                   C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34767"
FT                   /db_xref="GOA:A8FPJ4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ4"
FT                   /protein_id="ABV34767.1"
FT                   /translation="MNKPSALPVLYSLRNCPYAIRARMAIYVSGQAVQLRDIVLSDKPA
FT                   HMLQVSPKGTVPVLVLQNDKVLEQSLEIMMWAFGQSDPNNYLMSDSPNTRAEMLSLVDL
FT                   FDTEFKLRLEKYRSAKRYHDESVLEHRLACEQYLKMLELKLSQHTYLMSDSPSLADLAI
FT                   LPFIRQLARVERQWYLQSPYPNIRKWLNDYLQSRMFSKVMSKYPMWLTEKSLIVFSADK
FT                   PLS"
     MNKPSALPVL YSLRNCPYAI RARMAIYVSG QAVQLRDIVL SDKPAHMLQV SPKGTVPVLV        60
     LQNDKVLEQS LEIMMWAFGQ SDPNNYLMSD SPNTRAEMLS LVDLFDTEFK LRLEKYRSAK       120
     RYHDESVLEH RLACEQYLKM LELKLSQHTY LMSDSPSLAD LAILPFIRQL ARVERQWYLQ       180
     SPYPNIRKWL NDYLQSRMFS KVMSKYPMWL TEKSLIVFSA DKPLS                       225
//

If you have problems or comments...

PBIL Back to PBIL home page