(data stored in ACNUC7421 zone)

EMBL: CP000821.PE157

CP000821.PE157       Location/Qualifiers
FT   CDS             180321..180890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0157"
FT                   /product="LemA family protein"
FT                   /note="KEGG: slo:Shew_3652 LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34770"
FT                   /db_xref="GOA:A8FPJ7"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ7"
FT                   /protein_id="ABV34770.1"
FT                   /translation="MEGLLLGLGLLVIIAYLWYVSLVKKRNSVREALSGIDVQLKKRSN
FT                   LVPNILKIAQKFMDHEKSLLTEITELRAQVEKSYDIGDASAVKEHLVKAELLNGKMGQL
FT                   MVSVENYPELKSDNTMLQAMQTYNEVEAHISAARRFYNASVTELNNAVEIFPGSIIASM
FT                   ANIKVMPFYEADEASKAPVDASDYLN"
     MEGLLLGLGL LVIIAYLWYV SLVKKRNSVR EALSGIDVQL KKRSNLVPNI LKIAQKFMDH        60
     EKSLLTEITE LRAQVEKSYD IGDASAVKEH LVKAELLNGK MGQLMVSVEN YPELKSDNTM       120
     LQAMQTYNEV EAHISAARRF YNASVTELNN AVEIFPGSII ASMANIKVMP FYEADEASKA       180
     PVDASDYLN                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page