(data stored in ACNUC7421 zone)

EMBL: CP000821.PE158

CP000821.PE158       Location/Qualifiers
FT   CDS             180949..181959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34771"
FT                   /db_xref="GOA:A8FPJ8"
FT                   /db_xref="InterPro:IPR021484"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ8"
FT                   /protein_id="ABV34771.1"
FT                   /translation="MNIISFLFGARIKPKRQAKPLSAVGDELESLQAHYDEHIEPLTRK
FT                   FENRRVACLKALRLRIYMSIGIFAAVLFICLLFDSTQRIVIPWPFYLLPLVPLCWWCSR
FT                   PVTHYQSDVKLQVFPKIFRYFGDDFIFSPTHSMSMSTLKRSKLLPGYDKAHFDDYVQGT
FT                   HRGIEIAINELALTKEVRRDKRNETKTVFNGVMVQLGCHKKFNGHTVVVRNRGSLMNFL
FT                   SDSFKRLSRVKLEDPRFEKLFDVFSSDQIEARYLLTVSFMERLQELADCFSGQFQCAFY
FT                   EDKLLIMLASRENRFELGSIFHGATFEYEFSQINREMRQLFAMIEVLKLDEYTGL"
     MNIISFLFGA RIKPKRQAKP LSAVGDELES LQAHYDEHIE PLTRKFENRR VACLKALRLR        60
     IYMSIGIFAA VLFICLLFDS TQRIVIPWPF YLLPLVPLCW WCSRPVTHYQ SDVKLQVFPK       120
     IFRYFGDDFI FSPTHSMSMS TLKRSKLLPG YDKAHFDDYV QGTHRGIEIA INELALTKEV       180
     RRDKRNETKT VFNGVMVQLG CHKKFNGHTV VVRNRGSLMN FLSDSFKRLS RVKLEDPRFE       240
     KLFDVFSSDQ IEARYLLTVS FMERLQELAD CFSGQFQCAF YEDKLLIMLA SRENRFELGS       300
     IFHGATFEYE FSQINREMRQ LFAMIEVLKL DEYTGL                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page