(data stored in ACNUC7421 zone)

EMBL: CP000821.PE159

CP000821.PE159       Location/Qualifiers
FT   CDS             181968..182705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0159"
FT                   /product="lytic transglycosylase, catalytic"
FT                   /note="KEGG: slo:Shew_3650 lytic transglycosylase,
FT                   catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34772"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ9"
FT                   /protein_id="ABV34772.1"
FT                   /translation="MHAICCGGIVSSLLWLAGVTHSYAQVTIERDAKPHYKASYSKEGI
FT                   LGKSSTAHPASFSPSKEAENQLKVYQYRQENGVMAFSDHAPGSAQYQVLLYDCYACQPD
FT                   SSLDWKKIPLFYRDYDELINQAANTHNLDPALIRAVIHAESAFKVFALSRSGAMGLMQL
FT                   MPETAKELGVKNAFKPEQNIDGGAKYLAQMLRRFDGDIDLACAAYNAGPMNVTHYKGIP
FT                   PYPETQAYVKRVKILLERYRKPG"
     MHAICCGGIV SSLLWLAGVT HSYAQVTIER DAKPHYKASY SKEGILGKSS TAHPASFSPS        60
     KEAENQLKVY QYRQENGVMA FSDHAPGSAQ YQVLLYDCYA CQPDSSLDWK KIPLFYRDYD       120
     ELINQAANTH NLDPALIRAV IHAESAFKVF ALSRSGAMGL MQLMPETAKE LGVKNAFKPE       180
     QNIDGGAKYL AQMLRRFDGD IDLACAAYNA GPMNVTHYKG IPPYPETQAY VKRVKILLER       240
     YRKPG                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page