(data stored in ACNUC7421 zone)

EMBL: CP000821.PE162

CP000821.PE162       Location/Qualifiers
FT   CDS             185416..185787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_0958 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34775"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK2"
FT                   /protein_id="ABV34775.1"
FT                   /translation="MHTSLKKKLVELELYLLKADVRVSVQDLDQLIHDDFLEFGGSGIS
FT                   FGKKEVLKQLPREKCPEFSATAFELRHLSCDVAQLVYRATMKKPGEFITRYSLRSSLWR
FT                   KSQGRWQMIFHQGTPCEPF"
     MHTSLKKKLV ELELYLLKAD VRVSVQDLDQ LIHDDFLEFG GSGISFGKKE VLKQLPREKC        60
     PEFSATAFEL RHLSCDVAQL VYRATMKKPG EFITRYSLRS SLWRKSQGRW QMIFHQGTPC       120
     EPF                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page