(data stored in ACNUC7421 zone)

EMBL: CP000821.PE163

CP000821.PE163       Location/Qualifiers
FT   CDS             complement(185896..186738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0163"
FT                   /product="protein of unknown function DUF519"
FT                   /note="KEGG: slo:Shew_3648 protein of unknown function
FT                   DUF519"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34776"
FT                   /db_xref="GOA:A8FPK3"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK3"
FT                   /protein_id="ABV34776.1"
FT                   /translation="MLSYRHGYHAGNYADVLKHSVLLQVLKLMHKKPTPFVYIDTHAGA
FT                   GGYALSDEFAQKTGEYLEGVAKLWGKEDLPEPLAEYIADVTHFNQGKPELSFYPGSPAF
FT                   VDMNSYEKERMVLHELHGADHAQLEEQFAGDRYIRIVKDDGLKGLIAAVPPRERRGVIL
FT                   VDPSYEMKTDYQDVPNAIIKAHKKFATGVYMLWYPVVNRAQTEGMLKILAQSGIKNQLR
FT                   IEQSVRADSDEFGMTAAGLWIINPPWQLDSKADEILEYLSPLLNQGGGKVTMKLEVGE"
     MLSYRHGYHA GNYADVLKHS VLLQVLKLMH KKPTPFVYID THAGAGGYAL SDEFAQKTGE        60
     YLEGVAKLWG KEDLPEPLAE YIADVTHFNQ GKPELSFYPG SPAFVDMNSY EKERMVLHEL       120
     HGADHAQLEE QFAGDRYIRI VKDDGLKGLI AAVPPRERRG VILVDPSYEM KTDYQDVPNA       180
     IIKAHKKFAT GVYMLWYPVV NRAQTEGMLK ILAQSGIKNQ LRIEQSVRAD SDEFGMTAAG       240
     LWIINPPWQL DSKADEILEY LSPLLNQGGG KVTMKLEVGE                             280
//

If you have problems or comments...

PBIL Back to PBIL home page