(data stored in ACNUC7421 zone)

EMBL: CP000821.PE164

CP000821.PE164       Location/Qualifiers
FT   CDS             186935..187711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0164"
FT                   /product="protein of unknown function DUF548"
FT                   /note="KEGG: slo:Shew_3647 protein of unknown function
FT                   DUF548"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34777"
FT                   /db_xref="GOA:A8FPK4"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPK4"
FT                   /protein_id="ABV34777.1"
FT                   /translation="MTELKQSIQPIGIFFNAQYPSLEAICQRWGLVFDKEAAFELVFEN
FT                   NCLVLNKRDEPKLKGISVDFVSGAVAHRRKFGGGRGQSIAKAVGLKQGVNPSVVDGTAG
FT                   LGRDAFVLASLGCNVTMVERNPVVAALLEDGLRRAYESEEIGDWMRERMRLVHGSSLES
FT                   VAELGEEIDVVYLDPMYPHREKSALVKKEMRVFQSLVGADLDADGLLAPATALATKRVV
FT                   VKRPDYAEDLDGVKPSMVISTKKNRFDVYVKAAMKA"
     MTELKQSIQP IGIFFNAQYP SLEAICQRWG LVFDKEAAFE LVFENNCLVL NKRDEPKLKG        60
     ISVDFVSGAV AHRRKFGGGR GQSIAKAVGL KQGVNPSVVD GTAGLGRDAF VLASLGCNVT       120
     MVERNPVVAA LLEDGLRRAY ESEEIGDWMR ERMRLVHGSS LESVAELGEE IDVVYLDPMY       180
     PHREKSALVK KEMRVFQSLV GADLDADGLL APATALATKR VVVKRPDYAE DLDGVKPSMV       240
     ISTKKNRFDV YVKAAMKA                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page