(data stored in ACNUC7421 zone)

EMBL: CP000821.PE165

CP000821.PE165       Location/Qualifiers
FT   CDS             complement(187715..188101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34778"
FT                   /db_xref="GOA:A8FPK5"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK5"
FT                   /protein_id="ABV34778.1"
FT                   /translation="MNRLVVSLALVFFAFILWVIYLANTGSTSVFFELVGVLPYGDKLG
FT                   HFCLFGMLTFLFNLASRCKSFPIGRFRLYYGTAVVTIFVLAEEISQGFIPSRTFDLMDL
FT                   TADALGILSFTYVTYLSSKTPMKA"
     MNRLVVSLAL VFFAFILWVI YLANTGSTSV FFELVGVLPY GDKLGHFCLF GMLTFLFNLA        60
     SRCKSFPIGR FRLYYGTAVV TIFVLAEEIS QGFIPSRTFD LMDLTADALG ILSFTYVTYL       120
     SSKTPMKA                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page