(data stored in ACNUC7421 zone)

EMBL: CP000821.PE166

CP000821.PE166       Location/Qualifiers
FT   CDS             complement(188256..189107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34779"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK6"
FT                   /protein_id="ABV34779.1"
FT                   /translation="MNKLTLGATIAVLGLSLNVNAEETSSPLAMSIISGMEAYEDSPGS
FT                   SLSKGAGISLIWDDLRYDKTYKLDTNYFRARGTYYYEKDSEKYDEDRYRDSMDLKLHYQ
FT                   RPFMSINNDDDYTLSVIGHYEGHYNSQQLEEFEQLAVGGLALNRRFGDTHHYDLGVTLG
FT                   LAFSEEEKDDDWPRESQGITEEELNRRGFGYYFELKNKYTFSHTGVQLSLNYSRYDGLW
FT                   KYEDNKSYTFNKVNFGVVIPLANKNNLLHFATEYIDRTSEQDLIGFDDVLYRVHAEYVH
FT                   YF"
     MNKLTLGATI AVLGLSLNVN AEETSSPLAM SIISGMEAYE DSPGSSLSKG AGISLIWDDL        60
     RYDKTYKLDT NYFRARGTYY YEKDSEKYDE DRYRDSMDLK LHYQRPFMSI NNDDDYTLSV       120
     IGHYEGHYNS QQLEEFEQLA VGGLALNRRF GDTHHYDLGV TLGLAFSEEE KDDDWPRESQ       180
     GITEEELNRR GFGYYFELKN KYTFSHTGVQ LSLNYSRYDG LWKYEDNKSY TFNKVNFGVV       240
     IPLANKNNLL HFATEYIDRT SEQDLIGFDD VLYRVHAEYV HYF                         283
//

If you have problems or comments...

PBIL Back to PBIL home page