(data stored in ACNUC7421 zone)

EMBL: CP000821.PE167

CP000821.PE167       Location/Qualifiers
FT   CDS             complement(189301..190611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0167"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: slo:Shew_3638 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34780"
FT                   /db_xref="GOA:A8FPK7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK7"
FT                   /protein_id="ABV34780.1"
FT                   /translation="MKWLKKFLPRSAFSQTVMLIGCLLLINQLVSYLSVATYFIQPTYQ
FT                   QINQLIARQVKLLFVDGVDIGREHLTMVDALNAKVRDDGMEIYNQKQAREAGIDQAVYY
FT                   GFLSSQMSEHLGGKAEVKIAQGDDFEIWIRPPQAPSIWIKVPLTGFNESDLSPLTLYLM
FT                   VIGALSVAGGWWFARQQNRPLKKLQKAAISVSMGDYPEPLPLTGSTEIVEVTNAFNQMS
FT                   HSMKQLEQDRALLMAGISHDLRTPLTRIRLASEMMVEEDEYLKDGIVHDIEDMDAIINQ
FT                   FISYIRQDQESTREQGQLNDLIEDVVQAESNREAKIEVELNECPEIPMQSIAIKRILSN
FT                   LVENAFRYGRGWVKLSSHFDGKRVGFSVEDDGPGIPEDQIPKLFQPFTQGDTARGSVGS
FT                   GLGLAIIKRITDRHQGEVVLTNRAEGGLRAQVWLPME"
     MKWLKKFLPR SAFSQTVMLI GCLLLINQLV SYLSVATYFI QPTYQQINQL IARQVKLLFV        60
     DGVDIGREHL TMVDALNAKV RDDGMEIYNQ KQAREAGIDQ AVYYGFLSSQ MSEHLGGKAE       120
     VKIAQGDDFE IWIRPPQAPS IWIKVPLTGF NESDLSPLTL YLMVIGALSV AGGWWFARQQ       180
     NRPLKKLQKA AISVSMGDYP EPLPLTGSTE IVEVTNAFNQ MSHSMKQLEQ DRALLMAGIS       240
     HDLRTPLTRI RLASEMMVEE DEYLKDGIVH DIEDMDAIIN QFISYIRQDQ ESTREQGQLN       300
     DLIEDVVQAE SNREAKIEVE LNECPEIPMQ SIAIKRILSN LVENAFRYGR GWVKLSSHFD       360
     GKRVGFSVED DGPGIPEDQI PKLFQPFTQG DTARGSVGSG LGLAIIKRIT DRHQGEVVLT       420
     NRAEGGLRAQ VWLPME                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page